PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C04578.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CPP
Protein Properties Length: 775aa    MW: 83843.2 Da    PI: 7.1842
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C04578.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.39.7e-16461501242
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                     ++k+C+CkkskClk+YCeCfaag++Cse C+C++C N+e++
  Pahal.C04578.1 461 SCKRCSCKKSKCLKLYCECFAAGVYCSEPCTCQGCLNNESH 501
                     689**********************************9976 PP

2TCR521.4e-16546584139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+CkN 
  Pahal.C04578.1 546 RHKRGCNCKKSSCLKKYCECFQGGVGCSISCRCEGCKNA 584
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.6E-17460501IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.873461586IPR005172CRC domain
PfamPF036381.5E-11463499IPR005172CRC domain
SMARTSM011142.5E-17546587IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.7E-12548584IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 775 aa     Download sequence    Send to blast
MDTPDRPRAG AAAAAAGFED SPVFNFINNL SPIPPPKPSE TAHNVQLFKS LDLAPVSSIF  60
ASPHVNPAKE PKILIRDDSI QLPQDLHSPN SVRTRVGSTI TFRMIRCRDI VSENCNINCR  120
LNEAPIDPSD HTSNSESQLP QSMQNGVGSV ESDKDQCADG KTDLTISQEC TDLEGMNLDE  180
SGPDKMDPSH SRMDLHESQL SEQNKDEPAA YNGDYMIANQ PNSDMLTLSL PFGTETQSVN  240
DTQEADNSNS AKSLLNEEPN YYIQNSAHEP HLYWTGAVEG AAVDYTPQAL PGALQSQLMP  300
CNKLNDPRDY MPTEQNGLSQ HLRGTRRRSL FNEKAGASNK SVDKASDRRS VNSTTPKCKT  360
IPGDINSKPL RTPPCALPGI GLHLNALAAI PKEKIVSRDI LSNINESSNL PCPAGSSPPP  420
SEQNIINDDF AQRTDVASAE PSSQGSPKKK RHKFDNGDGT SCKRCSCKKS KCLKLYCECF  480
AAGVYCSEPC TCQGCLNNES HMETVLSTRQ QIESRNPLAF APKVIHTSEP GLELGDFNNK  540
TPASARHKRG CNCKKSSCLK KYCECFQGGV GCSISCRCEG CKNAFGRREG VAVLSIEEPK  600
QASEENNACV KEEKCEIDKQ LVIYQATDLA PAENLLTTPS MVECRPLACL PPPSSKKPSS  660
KKPRSSTKLV GHPSRLCNSQ APLKTDILLS QFGNYAEMVL GDSTSDTLKG NSSPQTSVKV  720
VSPNKKRVSP PRMGTGLSPI CKSGRKLILK SIPSFPSLGG DLNNEDPKSK TPAP*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963116.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
TrEMBLK3Z3P10.0K3Z3P1_SETIT; Uncharacterized protein
STRINGSi021159m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP127462630
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.13e-72Tesmin/TSO1-like CXC domain-containing protein